PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000169621
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 471aa    MW: 51678.3 Da    PI: 9.0951
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000169621genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46e-33194250360
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  MDP0000169621 194 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSL-DGQIAEIVYKGEHNHSK 250
                    9***************************************.***************85 PP

2WRKY103.61.1e-32394450359
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    Dg++WrKYGqK+vkg+++prsYYrCts +C+v+k+ver ++dpk++++tYeg+Hnh+
  MDP0000169621 394 DGFRWRKYGQKVVKGNPYPRSYYRCTSLKCSVRKHVERVSDDPKAFITTYEGKHNHD 450
                    9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-30184251IPR003657WRKY domain
SuperFamilySSF1182904.05E-26189251IPR003657WRKY domain
SMARTSM007743.8E-37192250IPR003657WRKY domain
PfamPF031061.5E-25194248IPR003657WRKY domain
PROSITE profilePS5081123.686194251IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-34378452IPR003657WRKY domain
SuperFamilySSF1182901.19E-28386452IPR003657WRKY domain
PROSITE profilePS5081134.842387452IPR003657WRKY domain
SMARTSM007743.6E-37392451IPR003657WRKY domain
PfamPF031067.9E-26394450IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MDIKEAERVV IAKPVASRPT CSTFRSFTEL LAGAIDASPL NVSSETAVPA IRPKTVRFKP  60
MVNHTVAGLV SSQAHISGAA HSHSSEQVSK SDSRSTVIYK PLAKVVSRAT FSVLANMGNF  120
NTSHQSTQSS VNVGVLHPNQ DKCFRSQSAN LHHNNPSCAE TNQTTEPPKI ASQNMEEDLK  180
LIPSTANTDR PSYDGYNWRK YGQKQVKGSE YPRSYYKCTH PNCPVKKKVE RSLDGQIAEI  240
VYKGEHNHSK PQPPKRSSSG TQGLGVPSNG TGQDTNNRLL NSHINERNEG SEGRVEDQNE  300
VGLPVQSYQT KAPLPYDPHA TGGITAGGAT PDNSCGLSGE CEEASKRLEA EDYEPRSKRR  360
KSENHSLEAG ISGEGVQDPR VVVQNSVESD MTGDGFRWRK YGQKVVKGNP YPRSYYRCTS  420
LKCSVRKHVE RVSDDPKAFI TTYEGKHNHD MPLRNTNAGA SEKDTTTKEK P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-32194452877Probable WRKY transcription factor 4
2lex_A1e-32194452877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.116540.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0201090.0KJ020109.1 Malus hybrid cultivar TTG2 protein (TTG2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369813.10.0PREDICTED: WRKY transcription factor 44-like
RefseqXP_008369812.10.0PREDICTED: WRKY transcription factor 44-like
TrEMBLX2F1V20.0X2F1V2_9R
STRINGVIT_08s0040g03070.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67903450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-112WRKY family protein